PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN37484.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family G2-like
Protein Properties Length: 414aa    MW: 45964 Da    PI: 6.6829
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN37484.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like103.41.4e-32272327156
     G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                 k+r++W+peLH+rFv+a+++LGGs++AtPk+i+elm+v+gLt+++vkSHLQkYRl+
  KHN37484.1 272 KQRRCWSPELHRRFVNALQKLGGSQVATPKQIRELMQVDGLTNDEVKSHLQKYRLH 327
                 79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.461269329IPR017930Myb domain
SuperFamilySSF466893.59E-18269330IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.2E-29270330IPR009057Homeodomain-like
TIGRFAMsTIGR015571.8E-27272327IPR006447Myb domain, plants
PfamPF002494.2E-8274325IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 414 aa     Download sequence    Send to blast
MGSVPAELSL DLRPTFIPKT ITDFLRHLSD NNNPPATLHD FLARLEDELR KIHAFKRELP  60
LSMLLLNDAI SVLKAESQKC RVARDSAPVL EEFIPLKKER GDQSEEEEEE EENDDDDDNE  120
CRDKRNWMSS VQLWNNNTTT ATTNNNNPSD RKQLLHKLQT KKSEEGQSVV EDPFQTCSNI  180
NEGRRAFMPF SRYSSSSSSV PVTTVGLGAA ASKEEKEESV MNRLSLLTPS SVKEGCGSRG  240
SRSSSNRAVS SSSPPMVQPS LRATSLQQTA RKQRRCWSPE LHRRFVNALQ KLGGSQVATP  300
KQIRELMQVD GLTNDEVKSH LQKYRLHTRR VPAASSNQPV VVLGGLWMSQ DQYNDSSKVS  360
SSGSGSPQSP LHLAAGSRGG TSPTEGDSME DDEDARSESF SWKSHMHKAG KVDV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0963770.0BT096377.1 Soybean clone JCVI-FLGm-15D9 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003518860.10.0PREDICTED: uncharacterized protein LOC100806237
TrEMBLA0A0B2RZ420.0A0A0B2RZ42_GLYSO; Two-component response regulator ARR1
TrEMBLI1JEX50.0I1JEX5_SOYBN; Uncharacterized protein
STRINGGLYMA02G15320.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF120834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.11e-51G2-like family protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]